Showing 761 - 770 of 2039 Items
A 60 yr record of atmospheric carbon monoxide reconstructed from Greenland firn air
Date: 2013-08-19
Creator: V. V. Petrenko
P. Martinerie
P. Novelli
D. M. Etheridge
I., Levin
Z. Wang
T. Blunier
J. Chappellaz
J. Kaiser
P. Lang
L. P. Steele
S. Hammer
J. Mak
R. L. Langenfelds
J. Schwander
J. P. Severinghaus
E. Witrant
G. Petron
M. O. Battle
G. Forster
W. T. Sturges
J. F. Lamarque
K. Steffen
J. W.C. White
Access: Open access
- We present the first reconstruction of the Northern Hemisphere (NH) high latitude atmospheric carbon monoxide (CO) mole fraction from Greenland firn air. Firn air samples were collected at three deep ice core sites in Greenland (NGRIP in 2001, Summit in 2006 and NEEM in 2008). CO records from the three sites agree well with each other as well as with recent atmospheric measurements, indicating that CO is well preserved in the firn at these sites. CO atmospheric history was reconstructed back to the year 1950 from the measurements using a combination of two forward models of gas transport in firn and an inverse model. The reconstructed history suggests that Arctic CO in 1950 was 140-150 nmol mol-1, which is higher than today's values. CO mole fractions rose by 10-15 nmol mol-1 from 1950 to the 1970s and peaked in the 1970s or early 1980s, followed by a ≈ 30 nmol mol-1 decline to today's levels. We compare the CO history with the atmospheric histories of methane, light hydrocarbons, molecular hydrogen, CO stable isotopes and hydroxyl radicals (OH), as well as with published CO emission inventories and results of a historical run from a chemistry-transport model. We find that the reconstructed Greenland CO history cannot be reconciled with available emission inventories unless unrealistically large changes in OH are assumed. We argue that the available CO emission inventories strongly underestimate historical NH emissions, and fail to capture the emission decline starting in the late 1970s, which was most likely due to reduced emissions from road transportation in North America and Europe. © Author(s) 2013.
Measurement of the ratio B(D0'e)B(D0K-e+e)
Date: 1991-01-01
Creator: G. Crawford
R. Fulton
K. K. Gan
T. Jensen
D. R., Johnson
H. Kagan
R. Kass
R. Malchow
F. Morrow
J. Whitmore
P. Wilson
D. Bortoletto
D. Brown
J. Dominick
R. L. McIlwain
D. H. Miller
M. Modesitt
C. R. Ng
S. F. Schaffner
E. I. Shibata
I. P.J. Shipsey
M. Battle
P. Kim
H. Kroha
K. Sparks
E. H. Thorndike
C. H. Wang
M. S. Alam
I. J. Kim
B. Nemati
V. Romero
Access: Open access
- Using the CLEO detector at the Cornell Electron Storage Ring, we have performed a direct measurement of the ratio of D0 semileptonic branching fractions into vector and pseudoscalar final states. We find B(D0K*-e+e)B(D0K-e+e)=0.510.180.06, in agreement with the ratio derived by the E691 experiment which compares D+ and D0 final states. We also set an upper limit on the ratio B(D0*0-e+e)B(D0K*-e+e)<0.64 at 90% confidence level. © 1991 The American Physical Society.
The moment of inertia of the binary pulsar J0737-3039A: Constraining the nuclear equation of state
Date: 2004-01-01
Creator: I.A. Morrison
T.W. Baumgarte
S.L. Shapiro
V.R. Pandharipande
Access: Open access
Molecular, mass spectral, and physiological analyses of orcokinins and orcokinin precursor-related peptides in the lobster Homarus americanus and the crayfish Procambarus clarkii
Date: 2009-02-01
Creator: Patsy S. Dickinson
Elizabeth A. Stemmler
Elizabeth E. Barton
Christopher R. Cashman
Noah P., Gardner
Szymon Rus
Henry R. Brennan
Timothy S. McClintock
Andrew E. Christie
Access: Open access
- Recently, cDNAs encoding prepro-orcokinins were cloned from the crayfish Procambarus clarkii; these cDNAs encode multiple copies of four orcokinin isoforms as well as several other peptides. Using the translated open reading frames of the P. clarkii transcripts as queries, five ESTs encoding American lobster Homarus americanus orthologs were identified via BLAST analysis. From these clones, three cDNAs, each encoding one of two distinct prepro-hormones, were characterized. Predicted processing of the deduced prepro-hormones would generate 13 peptides, 12 of which are conserved between the 2 precursors: the orcokinins NFDEIDRSGFGFN (3 copies), NFDEIDRSGFGFH (2 copies) and NFDEIDRSGFGFV (2 copies), FDAFTTGFGHN (an orcomyotropin-related peptide), SSEDMDRLGFGFN, GDY(SO3)DVYPE, VYGPRDIANLY and SAE. Additionally, one of two longer peptides (GPIKVRFLSAIFIPIAAPARSSPQQDAAAGYTDGAPV or APARSSPQQDAAAGYTDGAPV) is predicted from each prepro-hormone. MALDI-FTMS analyses confirmed the presence of all predicted orcokinins, the orcomyotropin-related peptide, and three precursor-related peptides, SSEDMDRLGFGFN, GDYDVYPE (unsulfated) and VYGPRDIANLY, in H. americanus neural tissues. SAE and the longer, unshared peptides were not detected. Similar complements of peptides are predicted from P. clarkii transcripts; the majority of these were detected in its neural tissues with mass spectrometry. Truncated orcokinins not predicted from any precursor were also detected in both species. Consistent with previous studies in the crayfish Orconectes limosus, NFDEIDRSGFGFN increased mid-/hindgut motility in P. clarkii. Surprisingly, the same peptide, although native to H. americanus, did not affect gut motility in this species. Together, our results provide the framework for future investigations of the regulation and physiological function of orcokinins/orcokinin precursor-related peptides in astacideans. © 2008 Elsevier Inc. All rights reserved.
Effect of differential rotation on the maximum mass of neutron stars: Realistic nuclear equations of state
Date: 2004-01-01
Creator: I.A. Morrison
T.W. Baumgarte
S.L. Shapiro
Access: Open access
General relativistic magnetohydrodynamics for the numerical construction of dynamical spacetimes
Date: 2003-01-01
Creator: T.W. Baumgarte
S.L. Shapiro
Access: Open access
Midgut epithelial endocrine cells are a rich source of the neuropeptides APSGFLGMRamide (Cancer borealis tachykinin-related peptide Ia) and GYRKPPFNGSIFamide (Gly1-SIFamide) in the crabs Cancer borealis, Cancer magister and Cancer productus
Date: 2007-02-01
Creator: Andrew E. Christie
Kimberly K. Kutz-Naber
Elizabeth A. Stemmler
Alexandra Klein
Daniel I., Messinger
Christopher C. Goiney
Anna J. Conterato
Emily A. Bruns
Yun Wei A. Hsu
Lingjun Li
Patsy S. Dickinson
Access: Open access
- Over a quarter of a century ago, Mykles described the presence of putative endocrine cells in the midgut epithelium of the crab Cancer magister (Mykles, 1979). In the years that have followed, these cells have been largely ignored and nothing is known about their hormone content or the functions they play in this species. Here, we used a combination of immunohistochemistry and mass spectrometric techniques to investigate these questions. Using immunohistochemistry, we identified both SIFamide-and tachykinin-related peptide (TRP)-like immunopositive cells in the midgut epithelium of C. magister, as well as in that of Cancer borealis and Cancer productus. In each species, the SIFamide-like labeling was restricted to the anterior portion of the midgut, including the paired anterior midgut caeca, whereas the TRP-like immunoreactivity predominated in the posterior midgut and the posterior midgut caecum. Regardless of location, label or species, the morphology of the immunopositive cells matched that of the putative endocrine cells characterized ultrastructurally by Mykles (Mykles, 1979). Matrix-assisted laser desorption/ ionization-Fourier transform mass spectrometry identified the peptides responsible for the immunoreactivities as GYRKPPFNGSIFamide (Gly 1-SIFamide) and APSGFLGMRamide [Cancer boreatis tachykinin-related peptide Ia (CabTRP Ia)], respectively, both of which are known neuropeptides of Cancer species. Although the function of these midgut-derived peptides remains unknown, we found that both Gly1-SIFamide and CabTRP Ia were released when the midgut was exposed to high-potassium saline. In addition, CabTRP Ia was detectable in the hemolymph of crabs that had been held without food for several days, but not in that of fed animals, paralleling results that were attributed to TRP release from midgut endocrine cells in insects. Thus, one function that midgut-derived CabTRP Ia may play in Cancer species is paracrine/hormonal control of feeding-related behavior, as has been postulated for TRPs released from homologous cells in insects.
Neurotransmitter interactions in the stomatogastric system of the spiny lobster: One peptide alters the response of a central pattern generator to a second peptide
Date: 1997-01-01
Creator: Patsy S. Dickinson
Wesley P. Fairfield
John R. Hetling
Jane Hauptman
Access: Open access
- Two of the peptides found in the stomatogastric nervous system of the spiny lobster. Panulirus interruptus, interacted to modulate the activity of the cardiac sac motor pattern. In the isolated stomatogastric ganglion, red- pigment-concentrating hormone (RPCH), but not proctolin, activated the bursting activity in the inferior ventricular (IV) neurons that drives the cardiac sac pattern. The cardiac sac pattern normally ceased within 15 min after the end of RPCH superfusion. However, when proctolin was applied within a few minutes of that time, it was likewise able to induce cardiac sac activity. Similarly, proctolin applied together with subthreshold RPCH induced cardiac sac bursting. The amplitude of the excitatory postsynaptic potentials from the IV neurons to the cardiac sac dilator neuron CD2 (1 of the 2 major motor neurons in the cardiac sac system) was potentiated in the presence of both proctolin and RPCH. The potentiation in RPCH was much greater than in proctolin alone. However, the potentiation in proctolin after RPCH was equivalent to that recorded in RPCH alone. Although we do not yet understand the mechanisms for these interactions of the two modulators, this study provides an example of one factor that can determine the 'state' of the system that is critical in determining the effect of a modulator that is 'state dependent,' and it provides evidence for yet another level of flexibility in the motor output of this system.
Focusing Surface-Acoustic-Wave Microcavities on GaAs
Date: 2020-01-22
Creator: Madeleine E. Msall
Paulo V. Santos
Access: Open access
- Focusing microcavities for surface acoustic waves (SAWs) produce highly localized strain and piezoelectric fields that can dynamically control excitations in nanostructures. Focusing transducers (FIDTs) that generate SAW beams that match nanostructure dimensions require pattern correction due to diffraction and wave-velocity anisotropy. The anisotropy correction is normally implemented by adding a quadratic term to the dependence of the wave velocity on the propagation angle. We show that a SAW focusing to a diffraction-limited size in GaAs requires corrections that more closely follow the group-velocity wave front, which is not a quadratic function. Optical interferometric mapping of the resultant SAW displacement field reveals tightly focused SAW beams on GaAs with a minimal beam waist. An additional set of Gouy-phase-corrected passive fingers creates an acoustic microcavity in the focal region with a small volume and a high quality factor. Our λSAW=5.6μm FIDTs are expected to scale well to the approximately 500-nm wavelength regime needed to study strong coupling between vibrations and electrons in electrostatic GaAs quantum dots.
Targeted identification of glycosylated proteins in the gastric pathogen helicobacter pylori (Hp)
Date: 2013-09-01
Creator: Kanokwan Champasa
Scott A. Longwell
Aimee M. Eldridge
Elizabeth A. Stemmler
Danielle H., Dube
Access: Open access
- Virulence of the gastric pathogen Helicobacter pylori (Hp) is directly linked to the pathogen's ability to glycosylate proteins; for example, Hp flagellin proteins are heavily glycosylated with the unusual nine-carbon sugar pseudaminic acid, and this modification is absolutely essential for Hp to synthesize functional flagella and colonize the host's stomach. Although Hp's glycans are linked to pathogenesis, Hp's glycome remains poorly understood; only the two flagellin glycoproteins have been firmly characterized in Hp. Evidence from our laboratory suggests that Hp synthesizes a large number of as-yet unidentified glycoproteins. Here we set out to discover Hp's glycoproteins by coupling glycan metabolic labeling with mass spectrometry analysis. An assessment of the subcellular distribution of azide-labeled proteins by Western blot analysis indicated that glycoproteins are present throughout Hp and may therefore serve diverse functions. To identify these species, Hp's azide-labeled glycoproteins were tagged via Staudinger ligation, enriched by tandem affinity chromatography, and analyzed by multidimensional protein identification technology. Direct comparison of enriched azide-labeled glycoproteins with a mock-enriched control by both SDS-PAGE and mass spectrometry-based analyses confirmed the selective enrichment of azide-labeled glycoproteins. We identified 125 candidate glycoproteins with diverse biological functions, including those linked with pathogenesis. Mass spectrometry analyses of enriched azide-labeled glycoproteins before and after cleavage of O-linked glycans revealed the presence of Staudinger ligation-glycan adducts in samples only after beta-elimination, confirming the synthesis of O-linked glycoproteins in Hp. Finally, the secreted colonization factors urease alpha and urease beta were biochemically validated as glycosylated proteins via Western blot analysis as well as by mass spectrometry analysis of cleaved glycan products. These data set the stage for the development of glycosylation-based therapeutic strategies, such as new vaccines based on natively glycosylated Hp proteins, to eradicate Hp infection. Broadly, this report validates metabolic labeling as an effective and efficient approach for the identification of bacterial glycoproteins. © 2013 by The American Society for Biochemistry and Molecular Biology, Inc.