Showing 41 - 50 of 257 Items
The Effects of Host Plant Species and Plant Quality on Growth and Development in the Meadow Spittlebug (Philaenus spumarius) on Kent Island in the Bay of Fundy
Date: 2020-03-01
Creator: Zoe M. Wood, Patricia L. Jones
Access: Open access
- Philaenus spumarius (Meadow Spittlebug, Homoptera: Cercopoidea) is a cosmopolitan generalist insect that feeds on a wide repertoire of host plants in the field. We studied density and growth of Meadow Spittlebugs on a range of host plants on Kent Island, a boreal island in the Bay of Fundy, NB, Canada. The highest spittlebug densities were on Cirsium arvense (Canadian Thistle), although spittlebugs had larger body sizes on Solidago rugosa (Rough-stemmed Goldenrod) and Anaphalis margaritacea (Pearly Everlasting). We fertilized plots of Rough-stemmed Goldenrod in the field over 3 weeks to examine the effects of plant quality on development of Meadow Spittlebugs. Following fertilization, there were fewer nymphs present in fertilized plots than in unfertilized plots, indicating faster nymph maturation to adulthood on fertilized plants. This study offers an initial report of the host plants used by Meadow Spittlebugs in northeastern boreal habitat, variation in density and performance of the species on a range of host plants, and the effects of plant fertilization on spittlebug life history.
Localization of DNA sequences promoting RNA polymerase I activity in Drosophila
Date: 1983-01-01
Creator: B. D. Kohorn, P. M.M. Rae
Access: Open access
Identification of the determinants for the specific recognition of single-strand telomeric DNA by Cdc13
Date: 2006-01-24
Creator: Aimee M. Eldridge, Wayne A. Halsey, Deborah S. Wuttke
Access: Open access
- The single-strand overhang present at telomeres plays a critical role in mediating both the capping and telomerase regulation functions of telomeres. The telomere end-binding proteins, Cdc13 in Saccharomyces cerevisiae, Pot1 in higher eukaryotes, and TEBP in the ciliated protozoan Oxytricha nova, exhibit sequence-specific binding to their respective single-strand overhangs. S. cerevisiae telomeres are composed of a heterogeneous mixture of GT-rich telomeric sequence, unlike in higher eukaryotes which have a simple repeat that is maintained with high fidelity. In yeast, the telomeric overhang is recognized by the essential protein Cdc13, which coordinates end-capping and telomerase activities at the telomere. The Cdc13 DNA-binding domain (Cdc13-DBD) binds these telomere sequences with high affinity (3 pM) and sequence specificity. To better understand the basis for this remarkable recognition, we have investigated the binding of the Cdc13-DBD to a series of altered DNA substrates. Although an 11-mer of GT-rich sequence is required for full binding affinity, only three of these 11 bases are recognized with high specificity. This specificity differs from that observed in the other known telomere end-binding proteins, but is well suited to the specific role of Cdc13 at yeast telomeres. These studies expand our understanding of telomere recognition by the Cdc13-DBD and of the unique molecular recognition properties of ssDNA binding. © 2006 American Chemical Society.
Disruption of topoisomerase II perturbs pairing in Drosophila cell culture
Date: 2007-09-01
Creator: Benjamin R. Williams, Jack R. Bateman, Natasha D. Novikov, C. Ting Wu
Access: Open access
- Homolog pairing refers to the alignment and physical apposition of homologous chromosomal segments. Although commonly observed during meiosis, homolog pairing also occurs in nonmeiotic cells of several organisms, including humans and Drosophila. The mechanism underlying nonmeiotic pairing, however, remains largely unknown. Here, we explore the use of established Drosophila cell lines for the analysis of pairing in somatic cells. Using fluorescent in situ hybridization (FISH), we assayed pairing at nine regions scattered throughout the genome of Kc167 cells, observing high levels of homolog pairing at all six euchromatic regions assayed and variably lower levels in regions in or near centromeric heterochromatin. We have also observed extensive pairing in six additional cell lines representing different tissues of origin, different ploidies, and two different species, demonstrating homolog pairing in cell culture to be impervious to cell type or culture history. Furthermore, by sorting Kc167 cells into G1, S, and G2 subpopulations, we show that even progression through these stages of the cell cycle does not significantly change pairing levels. Finally, our data indicate that disrupting Drosophila topoisomerase II (Top2) gene function with RNAi and chemical inhibitors perturbs homolog pairing, suggesting Top2 to be a gene important for pairing. Copyright © 2007 by the Genetics Society of America.
Down in arms: Marine climate stress inhibits growth and calcification of regenerating Asterias forbesi (Echinodermata: Asteroidea) arms
Date: 2021-01-01
Creator: Hannah L. Randazzo
Access: Open access
- Anthropogenic CO2 is changing the pCO2, temperature, and carbonate chemistry of seawater. These processes are termed ocean acidification (OA) and ocean warming. Previous studies suggest two opposing hypotheses for the way in which marine climate stress will influence echinoderm calcification, metabolic efficiency, and reproduction: either an additive or synergistic effect. Sea stars have a regenerative capacity, which may be particularly affected while rebuilding calcium carbonate arm structures, leading to changes in arm growth and calcification. In this study, Asterias forbesi were exposed to ocean water of either ambient, high temperature, high pCO2, or high temperature and high pCO2 for 60 days, and the regeneration length of the amputated arm was measured weekly. Ocean acidification conditions (pCO2 ~1180 μatm) had a negative impact on regenerated arm length, and an increase in temperature of +4°C above ambient conditions (Fall, Southern Gulf of Maine) had a positive effect on regenerated arm length, but the additive effects of these two factors resulted in smaller regenerated arms compared to ambient conditions. Sea stars regenerating under high pCO2 exhibited a lower proportion of calcified mass, which could be the result of a more energetically demanding calcification process associated with marine climate stress. These results indicate that A. forbesi calcification is sensitive to increasing pCO2, and that climate change will have an overall net negative effect on sea star arm regeneration. Such effects could translate into lower predation rates by a key consumer in the temperate rocky intertidal of North America.
Differential neuropeptide modulation of premotor and motor neurons in the lobster cardiac ganglion
Date: 2020-10-01
Creator: Emily R. Oleisky, Meredith E. Stanhope, J. Joe Hull, Andrew E. Christie, Patsy S., Dickinson
Access: Open access
- The American lobster, Homarus americanus, cardiac neuromuscular system is controlled by the cardiac ganglion (CG), a central pattern generator consisting of four premotor and five motor neurons. Here, we show that the premotor and motor neurons can establish independent bursting patterns when decoupled by a physical ligature. We also show that mRNA encoding myosuppressin, a cardioactive neuropeptide, is produced within the CG. We thus asked whether myosuppressin modulates the decoupled premotor and motor neurons, and if so, how this modulation might underlie the role(s) that these neurons play in myosuppressin's effects on ganglionic output. Although myosuppressin exerted dose-dependent effects on burst frequency and duration in both premotor and motor neurons in the intact CG, its effects on the ligatured ganglion were more complex, with different effects and thresholds on the two types of neurons. These data suggest that the motor neurons are more important in determining the changes in frequency of the CG elicited by low concentrations of myosuppressin, whereas the premotor neurons have a greater impact on changes elicited in burst duration. A single putative myosuppressin receptor (MSR-I) was previously described from the Homarus nervous system. We identified four additional putative MSRs (MSR-II-V) and investigated their individual distributions in the CG premotor and motor neurons using RT-PCR. Transcripts for only three receptors (MSR-II-IV) were amplified from the CG. Potential differential distributions of the receptors were observed between the premotor and motor neurons; these differences may contribute to the distinct physiological responses of the two neuron types to myosuppressin. NEW & NOTEWORTHY Premotor and motor neurons of the Homarus americanus cardiac ganglion (CG) are normally electrically and chemically coupled, and generate rhythmic bursting that drives cardiac contractions; we show that they can establish independent bursting patterns when physically decoupled by a ligature. The neuropeptide myosuppressin modulates different aspects of the bursting pattern in these neuron types to determine the overall modulation of the intact CG. Differential distribution of myosuppressin receptors may underlie the observed responses to myosuppressin.
High Cryptic Diversity across the Global Range of the Migratory Planktonic Copepods Pleuromamma piseki and P. gracilis
Date: 2013-10-22
Creator: Kristin M.K. Halbert, Erica Goetze, David B. Carlon
Access: Open access
- Although holoplankton are ocean drifters and exhibit high dispersal potential, a number of studies on single species are finding highly divergent genetic clades. These cryptic species complexes are important to discover and describe, as identification of common marine species is fundamental to understanding ecosystem dynamics. Here we investigate the global diversity within Pleuromamma piseki and P. gracilis, two dominant members of the migratory zooplankton assemblage in subtropical and tropical waters worldwide. Using DNA sequence data from the mitochondrial gene cytochrome c oxidase subunit II (mtCOII) from 522 specimens collected across the Pacific, Atlantic and Indian Oceans, we discover twelve well-resolved genetically distinct clades in this species complex (Bayesian posterior probabilities >0.7; 6.3-17% genetic divergence between clades). The morphologically described species P. piseki and P. gracilis did not form monophyletic groups, rather they were distributed throughout the phylogeny and sometimes co-occurred within well-resolved clades: this result suggests that morphological characters currently used for taxonomic identification of P. gracilis and P. piseki may be inaccurate as indicators of species' boundaries. Cryptic clades within the species complex ranged from being common to rare, and from cosmopolitan to highly restricted in distribution across the global ocean. These novel lineages appear to be ecologically divergent, with distinct biogeographic distributions across varied pelagic habitats. We hypothesize that these mtDNA lineages are distinct species and suggest that resolving their systematic status is important, given the ecological significance of the genus Pleuromamma in subtropical-tropical waters worldwide. © 2013 Halbert et al.
Molecular, mass spectral, and physiological analyses of orcokinins and orcokinin precursor-related peptides in the lobster Homarus americanus and the crayfish Procambarus clarkii
Date: 2009-02-01
Creator: Patsy S. Dickinson, Elizabeth A. Stemmler, Elizabeth E. Barton, Christopher R. Cashman, Noah P., Gardner, Szymon Rus, Henry R. Brennan, Timothy S. McClintock, Andrew E. Christie
Access: Open access
- Recently, cDNAs encoding prepro-orcokinins were cloned from the crayfish Procambarus clarkii; these cDNAs encode multiple copies of four orcokinin isoforms as well as several other peptides. Using the translated open reading frames of the P. clarkii transcripts as queries, five ESTs encoding American lobster Homarus americanus orthologs were identified via BLAST analysis. From these clones, three cDNAs, each encoding one of two distinct prepro-hormones, were characterized. Predicted processing of the deduced prepro-hormones would generate 13 peptides, 12 of which are conserved between the 2 precursors: the orcokinins NFDEIDRSGFGFN (3 copies), NFDEIDRSGFGFH (2 copies) and NFDEIDRSGFGFV (2 copies), FDAFTTGFGHN (an orcomyotropin-related peptide), SSEDMDRLGFGFN, GDY(SO3)DVYPE, VYGPRDIANLY and SAE. Additionally, one of two longer peptides (GPIKVRFLSAIFIPIAAPARSSPQQDAAAGYTDGAPV or APARSSPQQDAAAGYTDGAPV) is predicted from each prepro-hormone. MALDI-FTMS analyses confirmed the presence of all predicted orcokinins, the orcomyotropin-related peptide, and three precursor-related peptides, SSEDMDRLGFGFN, GDYDVYPE (unsulfated) and VYGPRDIANLY, in H. americanus neural tissues. SAE and the longer, unshared peptides were not detected. Similar complements of peptides are predicted from P. clarkii transcripts; the majority of these were detected in its neural tissues with mass spectrometry. Truncated orcokinins not predicted from any precursor were also detected in both species. Consistent with previous studies in the crayfish Orconectes limosus, NFDEIDRSGFGFN increased mid-/hindgut motility in P. clarkii. Surprisingly, the same peptide, although native to H. americanus, did not affect gut motility in this species. Together, our results provide the framework for future investigations of the regulation and physiological function of orcokinins/orcokinin precursor-related peptides in astacideans. © 2008 Elsevier Inc. All rights reserved.
Midgut epithelial endocrine cells are a rich source of the neuropeptides APSGFLGMRamide (Cancer borealis tachykinin-related peptide Ia) and GYRKPPFNGSIFamide (Gly1-SIFamide) in the crabs Cancer borealis, Cancer magister and Cancer productus
Date: 2007-02-01
Creator: Andrew E. Christie, Kimberly K. Kutz-Naber, Elizabeth A. Stemmler, Alexandra Klein, Daniel I., Messinger, Christopher C. Goiney, Anna J. Conterato, Emily A. Bruns, Yun Wei A. Hsu, Lingjun Li, Patsy S. Dickinson
Access: Open access
- Over a quarter of a century ago, Mykles described the presence of putative endocrine cells in the midgut epithelium of the crab Cancer magister (Mykles, 1979). In the years that have followed, these cells have been largely ignored and nothing is known about their hormone content or the functions they play in this species. Here, we used a combination of immunohistochemistry and mass spectrometric techniques to investigate these questions. Using immunohistochemistry, we identified both SIFamide-and tachykinin-related peptide (TRP)-like immunopositive cells in the midgut epithelium of C. magister, as well as in that of Cancer borealis and Cancer productus. In each species, the SIFamide-like labeling was restricted to the anterior portion of the midgut, including the paired anterior midgut caeca, whereas the TRP-like immunoreactivity predominated in the posterior midgut and the posterior midgut caecum. Regardless of location, label or species, the morphology of the immunopositive cells matched that of the putative endocrine cells characterized ultrastructurally by Mykles (Mykles, 1979). Matrix-assisted laser desorption/ ionization-Fourier transform mass spectrometry identified the peptides responsible for the immunoreactivities as GYRKPPFNGSIFamide (Gly 1-SIFamide) and APSGFLGMRamide [Cancer boreatis tachykinin-related peptide Ia (CabTRP Ia)], respectively, both of which are known neuropeptides of Cancer species. Although the function of these midgut-derived peptides remains unknown, we found that both Gly1-SIFamide and CabTRP Ia were released when the midgut was exposed to high-potassium saline. In addition, CabTRP Ia was detectable in the hemolymph of crabs that had been held without food for several days, but not in that of fed animals, paralleling results that were attributed to TRP release from midgut endocrine cells in insects. Thus, one function that midgut-derived CabTRP Ia may play in Cancer species is paracrine/hormonal control of feeding-related behavior, as has been postulated for TRPs released from homologous cells in insects.
Neurotransmitter interactions in the stomatogastric system of the spiny lobster: One peptide alters the response of a central pattern generator to a second peptide
Date: 1997-01-01
Creator: Patsy S. Dickinson, Wesley P. Fairfield, John R. Hetling, Jane Hauptman
Access: Open access
- Two of the peptides found in the stomatogastric nervous system of the spiny lobster. Panulirus interruptus, interacted to modulate the activity of the cardiac sac motor pattern. In the isolated stomatogastric ganglion, red- pigment-concentrating hormone (RPCH), but not proctolin, activated the bursting activity in the inferior ventricular (IV) neurons that drives the cardiac sac pattern. The cardiac sac pattern normally ceased within 15 min after the end of RPCH superfusion. However, when proctolin was applied within a few minutes of that time, it was likewise able to induce cardiac sac activity. Similarly, proctolin applied together with subthreshold RPCH induced cardiac sac bursting. The amplitude of the excitatory postsynaptic potentials from the IV neurons to the cardiac sac dilator neuron CD2 (1 of the 2 major motor neurons in the cardiac sac system) was potentiated in the presence of both proctolin and RPCH. The potentiation in RPCH was much greater than in proctolin alone. However, the potentiation in proctolin after RPCH was equivalent to that recorded in RPCH alone. Although we do not yet understand the mechanisms for these interactions of the two modulators, this study provides an example of one factor that can determine the 'state' of the system that is critical in determining the effect of a modulator that is 'state dependent,' and it provides evidence for yet another level of flexibility in the motor output of this system.